PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.WVE7Q
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB
Protein Properties Length: 442aa    MW: 49970.8 Da    PI: 4.8658
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.WVE7QgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-163683148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lvd+v+++G g+W+++ r  g+ R++k+c++rw ++l
      Araip.WVE7Q 36 KGPWTSIEDAILVDYVTKHGEGNWNAVQRNSGLARCGKSCRLRWANHL 83
                     79******************************************9986 PP

2Myb_DNA-binding52.21.4e-1689132146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ +++++++++G++ W++ a++++ gRt++++k++w++
      Araip.WVE7Q  89 KGAFTEEEERRIIELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 132
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.273183IPR017930Myb domain
SuperFamilySSF466897.49E-2934130IPR009057Homeodomain-like
SMARTSM007172.6E-123585IPR001005SANT/Myb domain
PfamPF002493.6E-133683IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-233790IPR009057Homeodomain-like
CDDcd001676.61E-103883No hitNo description
PROSITE profilePS5129425.57384138IPR017930Myb domain
SMARTSM007172.3E-1688136IPR001005SANT/Myb domain
PfamPF002491.6E-1589132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2591136IPR009057Homeodomain-like
CDDcd001671.58E-6103132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MSSMTNMGDG RKVPKSRRSP SSVEEPTTEG EGHFKKGPWT SIEDAILVDY VTKHGEGNWN  60
AVQRNSGLAR CGKSCRLRWA NHLRPDLKKG AFTEEEERRI IELHAKMGNK WARMAAELPG  120
RTDNEIKNYW NTRIKRMQRS GLPIYPPDIC LRVMHGNQES QNVGRLTDGV NQHDDLSQTD  180
TLNIPELDFK HVKIPEDPSI FDMPENSMFE QSSDSSYGYN MFPIMHPAKR LRESAEIMQY  240
APVYEEDYMS DEITNQFHGD PLNGNTCCSS SSSMPLSGGM KLELPSLQYL ETQQGIWDTP  300
ASPLPSLESV DTLSSGLLEP IMYQSTKHFQ VQETPDEAVK CKPEWDESGE PYSPLAQSSA  360
SVLTMCSPDG PQWVETIQDH NIKHELGTEF PTYCSGKDEK NMNQIHVTRP DALLDLAWFE  420
NSVVNCDGDK SFRKDAFNTF FG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29361367106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016194872.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A0R0GJT21e-167A0A0R0GJT2_SOYBN; Uncharacterized protein
TrEMBLK7LXA11e-167K7LXA1_SOYBN; Uncharacterized protein
STRINGGLYMA13G04031.11e-167(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26960.14e-76myb domain protein 81